MCo-CVX-6(1212) Protein Card

General Information
Name MCo-CVX-6
Sequence VCPKILQRCRRDSDCPGACICRGNGYCGSYRJCRGpRRBC
YJR
Class Cyclotide
Technique MS
Average Mass 4476.19
Monoisotopic Mass 4473
m/z M+H 4476.19
ProteinType Grafted
Parent MCoTI-I
Organism Synthetic
Notes
Cyclic Yes

Assay
No assays found

References
Lesniak, W.G., Aboye, T., Chatterjee, S., Camarero, J.A. and Nimmagadda, S. (2017) In vivo evaluation of an engineered cyclotide as specific CXCR4 imaging reagent Chemistry‚ÄďA European Journal 23:14469-14475

Cross-references
Nucleic acids
Structure
Links

Tools