cyI5(1207) Protein Card

General Information
Name cyI5
Sequence GNPGACGETCIWGKCYSASIGCSCSRYKVCTLN
Class Cyclotide
Technique MS
Average Mass 3408.88
Monoisotopic Mass 3406.41
m/z M+H 3408.88
ProteinType Wild type
Parent
Organism Viola inconspicua
Notes Sequence of cyI5 shares a novel “TLNGNPGA” motif in loop six with cyclotides cyI3,4,6. Fractions predominantly containing cyclotides cyI3−cyI6 demonstrated an MIC of 18 μM and 35 μM against E. coli ATCC and K. pneumoniae, respectively.
Cyclic Yes

Assay
No assays found

References
Parsley, Nicole C., Patric W. Sadecki, Conrad J. Hartmann, and Leslie M. Hicks (2019) Viola “inconspicua” No More: An Analysis of Antibacterial Cyclotides Journal of natural products :0-0

Cross-references
Nucleic acids
Structure
Links

Tools