cyI1(1203) Protein Card

General Information
Name cyI1
Sequence GTFPCGESCVYIPCISSVVGCSCKSKVCYKN
Class Cyclotide
Technique MS
Average Mass 3238.79
Monoisotopic Mass 3236.39
m/z M+H 3238.79
ProteinType Wild type
Parent
Organism Viola inconspicua
Notes The sequence of cyI1 shares a “GTXPCGE” motif with cyI2.
Cyclic Yes

Assay
No assays found

References
Parsley, Nicole C., Patric W. Sadecki, Conrad J. Hartmann, and Leslie M. Hicks (2019) Viola “inconspicua” No More: An Analysis of Antibacterial Cyclotides Journal of natural products :0-0

Cross-references
Nucleic acids
Structure
Links

Tools