TIPTOP7(331) Nucleic Acid Card

General Information
Name TIPTOP7
Sequence ATGGAGAGCAAGAAGCTTCTTCCGGTGGTGCTGGTGGCGA
TGGTGCTGGTTGCTACCTCGACATGCTTCAACGACGGCTA
CACAACAGACCTCATCTCCGACGGTCGAGCTCAAATGGAC
ATTAACGGTGGTGCCTGTCCCAAAATCTTGCAGAGATGCA
GACGCGACTCCGATTGCCCCGGTGCATGTATTTGCCGGGG
GAACGGGTATTGCGGTAGCGGTAGCGACGCAATAGACCTC
ATCTCCAACGGTCGAGCTCAAATCTACATTAACGGTGGTG
CCTGTCCCAAAATCTTGCAGAAATGCAGACGCGACTCCGA
TTGCCCTGGTGCATGTGTTTGCCAAGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGACCTCATCTCCGACGGTG
GAGCCCAAATCGACATTAACGGTGGTGCCTGTCCCAAAAT
CTTGCAGAAATGCAGACGCGACTCCGATTGCCCCGGCGCA
TGTGTTTGCCAGGGGAATGGGTATTGCGGTAGCGGTAGCG
ACGCGTTAGACCTCATGTCCGACGGTCGAGCTCAAATTGA
CATTAACGGTGGTGCCTGTCCCAGAATCTTGCAGAAATGC
AGGCGCAACTCCGATTGCCCCAGTGCATGTGTTTGCCAGG
GGAATGGGTATTGCGGTAGCGGTAGTGATGCGTTAGACCT
CATGTATGACGGTCGAGCCCAAATCGACATTAACGGTGGT
GCCTGTCCGAGAATCTTGAAGAAATGCAGACGCGACTCCG
ATTGCCCCGGTGCATGTGTTTGCCGGGGGAATGGGTATTG
CGGTAGCGGTAGTGATGCGTTAGACCTCATGTCCGACGGT
CGAGCCCAAATTGACATTAACGGTGGTGCCTGTCCCAGAA
TCTTGAAGAAATGCAGACGCGACTCCGATTGCCCCAGTGC
ATGTATTTGCCAGGGGAACGGGTATTGCGGTAGCGGTAGC
GACGCGTTAGACCTCATGTCCGACGGTGGAGCTCAAACTG
GCGAAGACATTAATGGCGGTGGAGTGTATGACGAGAAACA
AAGAGTCTGTCCTAGAATCTTAAAGAAATGCAGGCGCGAC
TCCGATTGCCCCGGTGAATGTATTTGCCAAGGGAACGGGT
ATTGTGGTTAA
Notes
Sequence translation MESKKLLPVVLVAMVLVATSTCFNDGYTTDLISDGRAQMD
INGGACPKILQRCRRDSDCPGACICRGNGYCGSGSDAI
DL ISNGRAQIYINGGACPKILQKCRRDSDCPGACVCQG
NGYC GSGSDALDLISDGGAQIDINGGACPKILQKCRRD
SDCPGA CVCQGNGYCGSGSDALDLMSDGRAQIDINGGA
CPRILQKC RRNSDCPSACVCQGNGYCGSGSDALDLMYD
GRAQIDINGG ACPRILKKCRRDSDCPGACVCRGNGYCG
SGSDALDLMSDG RAQIDINGGACPRILKKCRRDSDCPS
ACICQGNGYCGSGS DALDLMSDGGAQTGEDINGGGVYD
EKQRVCPRILKKCRRD SDCPGECICQGNGYCG
Organism Momordica dioica

References
Du J, Chan LY, Poth AG, Craik DJ (2019) Discovery and Characterization of Cyclic and Acyclic Trypsin Inhibitors from Momordica dioica. J Nat Prod. 82:293-300

Cross-references
Proteins Encoded TIPTOP7
Links GenBank MH547558