cT31 cds (partial)(325) Nucleic Acid Card

General Information
Name cT31 cds (partial)
Sequence CGGATCCTATAAATTGCTACATGCATGTAAAGGAAACCAA
CGCATACGAAACCAAATTTTGTTATTTTCCAAATCAAATA
ATGGCATATCTTCGACTTGCTCCTCTTGCTGTGATTTTCT
TCTTTGCTGTTATGTTTGCAGTGAAGAAGACGGAAGGAGG
TGATCCTCTTAAGTGTGGAGAATCTTGTTTCGCGGGTAAG
TGTTACACGCCAGGTTGTACATGTGATCGGCCAATATGCA
AAAAGAATCACATTGTTGCAGCTGAAGCTAAAAC
Notes
Sequence translation MAYLRLAPLAVIFFFAVMFAVKKTEGGDPLKCGESCFAGK
CYTPGCTCDRPICKKNHIVAAEAKT
Organism Clitoria ternatea L

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0

Cross-references
Proteins Encoded cT31
cT31 precursor (partial)
Links