Cter acyc 1 mRNA partial(318) Nucleic Acid Card

General Information
Name Cter acyc 1 mRNA partial
Sequence AATCGAATAATGACTTATGTTAGGCTTGCTCCTCTTATTG
TTATCTTCTTGCTTCTCCCTTCTGTGAAGAATACAGAAGC
TGTTGATGGCTTTTGCCTAGAAACATGTGTAATTCTTCCA
TGTTTTTCATCGGTTGCCGGCTGTTATTGTCATGGCAGCA
CTTGCATGCGTGGCACAACCATTGCATCTATGGCAAAGAC
GATAGATGAACATCGTAACTTATGTCAAACTCATGAGGAT
TGTATAACAAAAAAAAGTGGAAATTTTTGTGCTCGTTTTC
CTAATCATAATATTAATTATGGTTGGTGTTTTAATGCTGA
ATCTGA
Notes
Sequence translation MTYVRLAPLIVIFLLLPSVKNTEAVDGFCLETCVILPCFS
SVAGCYCHGSTCMRGTTIASMAKTIDEHRNLCQTHEDCIT
KKSGNFCARFPNHNINYGWCFNAES
Organism Clitoria ternatea L

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Proteins Encoded Cter acyc 1
Cter acyc 1 precursor (partial)
Links GenBank KR912006