Cter 16/ cliotide T28 mRNA complete(287) Nucleic Acid Card

General Information
Name Cter 16/ cliotide T28 mRNA complete
Sequence AGCAAGGAAGAATATGACAGCAAACCCTATAACCAATATA
TCACTTCTTTCGATCTACCAAATCAAAGAATGGCTTATGT
TAAGCATGCTCCTCTAGCTGTGGTCTTTCTGCTTGCCACT
TCTGTTATGTTCATAGTAAAGAATGCAGAAGCCGGCGGTA
GTATTCCTTGTGGAGAATCCTGTGTCTTTCTTCCATGTTT
CTTGCCTGGCTGTTCTTGCAAAAGCAGTGTTTGCTATTTA
AACCATATCATTGCATCTGATGCAAAGACAGTTGATGAAC
ACCACCTCTTATGTCAGTCTCACGAAGACTGCTTCAAAAA
AGGAACTGGAAACTTTTGCGCTGCTTTTCCTGACCATGAT
ATTGCATATGGCTGGTGTTTTCATGCTCAATCTGAAGGAT
ATTTATTGAAAGACTTCTTGAAGATGCCGAAAGGCATATT
GAAGATGCCTATGGAAATCGCCAATTGAAAATGATCTTGC
ATGATGCATCTACTACTAGTTTTAAATAAAAGATGTATCT
ACTACTTTGAATGAAGGGTTATGTACTCATTTGTTTGTGA
ATCCATTCACAATAATAATATAAATCCTTTTAAAAATAAG
AATTGGAAAAAAAGACTTATT
Notes
Sequence translation MAYVKHAPLAVVFLLATSVMFIVKNAEAGGSIPCGESCVF
LPCFLPGCSCKSSVCYLNHIIASDAKTVDEHHLLCQSHED
CFKKGTGNFCAAFPDHDIAYGWCFHAQSEGYLLKDFLKMP
KGILKMPMEIAN
Organism Clitoria ternatea L

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Proteins Encoded cliotide T28
cliotide T28 precursor
Links GenBank KR911970